PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28650.m000191
Common NameLOC8287884, RCOM_0300740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 764aa    MW: 85580 Da    PI: 5.0799
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28650.m000191genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.42e-1123917611373
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lL+ cA+avss+d + a+++L+++++++sp gd  qRla++f+++L+arla+++ ++y al++++ s    ++ l+a+ ++  ++P+ k++ +
  28650.m000191 391 LRTLLILCAQAVSSDDRRTANEILKQIRQHSSPFGDGSQRLAHCFANGLEARLAGTGAQIYTALSSEKLS---AADMLKAYLAYISACPFNKIAII 483
                    5789************************************************************999999...99********************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN+ Il   ++++++HiiDf+i +G+QWpaL+  L++R++gpp+lRiTg++ p+sg    e+++etg+rLak++e  +vpfe+n+ +ak++e+++
  28650.m000191 484 FANHNILAVSKNASTLHIIDFGILYGFQWPALIYRLSKREGGPPKLRITGIELPQSGfrPGERVQETGRRLAKYCELHKVPFEYNA-IAKKWETIQ 578
                    ********************************************************9*****************************.7******** PP

           GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +++L++++gE++aVn+ ++ ++llde+v ++s+r++vL+l++++sP++++++  + +++++ F++rf e+l ++salfd+++++++re++ r k E
  28650.m000191 579 IDDLKLNHGEVVAVNCLFRSKNLLDETVVVNSPRNAVLNLIRKMSPDIFIHAIVNGSYSAPFFVTRFRESLFHFSALFDMFDTNMSREDQMRLKFE 674
                    ************************************************************************************************ PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    +e+ gre+ nv+aceg+er+er et+++W+ r  +aG+k++pl+ +  k+ k+ +++ + + + v+++ +++++gWk+r +++ SaW
  28650.m000191 675 KEFYGREALNVIACEGSERVERPETYKQWQVRSLRAGLKQLPLEPQLLKKLKCRVKEGYHNDFVVDQDGQWMLQGWKGRIIYASSAW 761
                    *********************************************************99888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.089365742IPR005202Transcription factor GRAS
PfamPF035146.9E-110391761IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MGTDAGFAEF SGLKFEDEID FPDLHQYPTF TNGYKSNDPT FDIDFNFVDT SLVLLDSDPS  60
RSAPSSVATM EGDSPSDDND FSETVLNYIS QMLMEEDMEQ KPCMFHDPLA LQAAERSLYD  120
VLGEKYPSSP NQSSSFGDQF LVDSPDDGLS SRLSDYSSNS SSGSNTSSSA EQQWINGEFG  180
ECKPAFLQTP LPTNFVFQSS ANSSSQQPLK LKNGLANNAH DVMGSFESKI VVPNFFSERE  240
LALQFQRGVE EANRFLPKEN QLVIDLETNA SIPEMKEKNT KVVVKEENEE TEYSPISVKG  300
RKNREREDDD FDEERSNKQS AVYVDETELA EMFDKVLVCT GGGCRPPGCI LSDSSQSGSN  360
KALQQNGQTN GSNGGKARAK RQGNKKEVVD LRTLLILCAQ AVSSDDRRTA NEILKQIRQH  420
SSPFGDGSQR LAHCFANGLE ARLAGTGAQI YTALSSEKLS AADMLKAYLA YISACPFNKI  480
AIIFANHNIL AVSKNASTLH IIDFGILYGF QWPALIYRLS KREGGPPKLR ITGIELPQSG  540
FRPGERVQET GRRLAKYCEL HKVPFEYNAI AKKWETIQID DLKLNHGEVV AVNCLFRSKN  600
LLDETVVVNS PRNAVLNLIR KMSPDIFIHA IVNGSYSAPF FVTRFRESLF HFSALFDMFD  660
TNMSREDQMR LKFEKEFYGR EALNVIACEG SERVERPETY KQWQVRSLRA GLKQLPLEPQ  720
LLKKLKCRVK EGYHNDFVVD QDGQWMLQGW KGRIIYASSA WVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-423957618374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002533753.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9T6840.0B9T684_RICCO; Transcription factor, putative
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14